OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GAPDHS (NM_014364) Human Mass Spec Standard

Be the first to review this product
SKU
PH305362
GAPDHS MS Standard C13 and N15-labeled recombinant protein (NP_055179)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505454 GAPDHS mouse monoclonal antibody, clone OTI1F6 (formerly 1F6) 100 ul
$447.00
LY402320 Transient overexpression lysate of glyceraldehyde-3-phosphate dehydrogenase, spermatogenic (GAPDHS) (as WB positive control) 100 ug
$436.00

Other products for "GAPDHS or NM_014364"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205362
Predicted MW 44.5 kDa
Protein Sequence
Protein Sequence
>RC205362 protein sequence
Red=Cloning site Green=Tags(s)

MSKRDIVLTNVTVVQLLRQPCPVTRAPPPPEPKAEVEPQPQPEPTPVREEIKPPPPPLPPHPATPPPKMV
SVARELTVGINGFGRIGRLVLRACMEKGVKVVAVNDPFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVV
DNHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLSIQAASDHISAGAQRVVISAPSPDAPMFVMGVNEND
YNPGSMNIVSNASCTTNCLAPLAKVIHERFGIVEGLMTTVHSYTATQKTVDGPSRKAWRDGRGAHQNIIP
ASTGAAKAVTKVIPELKGKLTGMAFRVPTPDVSVVDLTCRLAQPAPYSAIKEAVKAAAKGPMAGILAYTE
DEVVSTDFLGDTHSSIFDAKAGIALNDNFVKLISWYDNEYGYSHRVVDLLRYMFSRDK

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055179
RefSeq Size 1492
RefSeq ORF 1224
Synonyms GAPD2; GAPDH-2; GAPDS; HEL-S-278; HSD-35
Locus ID 26330
UniProt ID O14556
Cytogenetics 19q13.12
Summary This gene encodes a protein belonging to the glyceraldehyde-3-phosphate dehydrogenase family of enzymes that play an important role in carbohydrate metabolism. Like its somatic cell counterpart, this sperm-specific enzyme functions in a nicotinamide adenine dinucleotide-dependent manner to remove hydrogen and add phosphate to glyceraldehyde 3-phosphate to form 1,3-diphosphoglycerate. During spermiogenesis, this enzyme may play an important role in regulating the switch between different energy-producing pathways, and it is required for sperm motility and male fertility. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GAPDHS" proteins (3)
SKU Description Size Price
LC402320 Lyophilized GAPDHS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402320 Transient overexpression lysate of glyceraldehyde-3-phosphate dehydrogenase, spermatogenic (GAPDHS) (as WB positive control) 100 ug
$436.00
TP305362 Recombinant protein of human glyceraldehyde-3-phosphate dehydrogenase, spermatogenic (GAPDHS), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products