OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EDIL3 (NM_005711) Human Mass Spec Standard

Be the first to review this product
SKU
PH305282
EDIL3 MS Standard C13 and N15-labeled recombinant protein (NP_005702)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349919 Rabbit Polyclonal Anti-EDIL3 Antibody
100 ul
$205.00
LY401742 Transient overexpression lysate of EGF-like repeats and discoidin I-like domains 3 (EDIL3) (as WB positive control) 100 ug
$436.00

Other products for "EDIL3 or NM_005711"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205282
Predicted MW 53.8 kDa
Protein Sequence
Protein Sequence
>RC205282 protein sequence
Red=Cloning site Green=Tags(s)

MKRSVAVWLLVGLSLSVPQFGKGDICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEE
EPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVAN
YSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAEN
DRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTP
YANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFT
WEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWT
VYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005702
RefSeq Size 4771
RefSeq ORF 1440
Synonyms DEL1
Locus ID 10085
UniProt ID O43854
Cytogenetics 5q14.3
Summary The protein encoded by this gene is an integrin ligand. It plays an important role in mediating angiogenesis and may be important in vessel wall remodeling and development. It also influences endothelial cell behavior. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EDIL3" proteins (4)
SKU Description Size Price
LC401742 Lyophilized EDIL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401742 Transient overexpression lysate of EGF-like repeats and discoidin I-like domains 3 (EDIL3) (as WB positive control) 100 ug
$436.00
TP305282 Recombinant protein of human EGF-like repeats and discoidin I-like domains 3 (EDIL3), 20 µg 20 ug
$737.00
TP720481 Recombinant protein of human EGF-like repeats and discoidin I-like domains 3 (EDIL3) 10 ug
$235.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products