OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

UNC50 (NM_014044) Human Mass Spec Standard

Be the first to review this product
SKU
PH305276
UNC50 MS Standard C13 and N15-labeled recombinant protein (NP_054763)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA341928 Rabbit Polyclonal Anti-UNC50 Antibody
100 ul
$585.00
LY402272 Transient overexpression lysate of unc-50 homolog (C. elegans) (UNC50) (as WB positive control) 100 ug
$436.00

Other products for "UNC50 or NM_014044"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205276
Predicted MW 30.4 kDa
Protein Sequence
Protein Sequence
>RC205276 protein sequence
Red=Cloning site Green=Tags(s)

MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYR
KQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVLIDCVGVGLLIATLMWFISNKY
LVKRQSRDYDVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTF
LGYSALPFLKNTVILLYPFAPLILLYGLSLALGWNFTHTLCSFYKYRVK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_054763
RefSeq Size 1167
RefSeq ORF 777
Synonyms GMH1; HSD23; PDLs22; UNCL; URP
Locus ID 25972
UniProt ID Q53HI1
Cytogenetics 2q11.2
Summary May be involved in cell surface expression of neuronal nicotinic receptors. Binds RNA (By similarity).UniProtKB/Swiss-Prot Function
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "UNC50" proteins (3)
SKU Description Size Price
LC402272 Lyophilized UNC50 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402272 Transient overexpression lysate of unc-50 homolog (C. elegans) (UNC50) (as WB positive control) 100 ug
$436.00
TP305276 Purified recombinant protein of Homo sapiens unc-50 homolog (C. elegans) (UNC50), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products