NAP1L2 (NM_021963) Human Mass Spec Standard

CAT#: PH305257

NAP1L2 MS Standard C13 and N15-labeled recombinant protein (NP_068798)

Product Images

Coomassie blue staining of purified NAP1L2 protein (Cat# TP305257). The protein was produced from HEK293T cells transfected with NAP1L2 cDNA clone (Cat# RC205257) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205257
• Predicted MW: 52.5 kDa
• Protein Sequence:
  Sequence Link

  >RC205257 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAKSENRKELSESSQEEAGNQIMVEGLGEHLERGEDAAAGLGDDGKCGEEAAAGLGEEGENGEDTAAGSG
  EDGKKGGDTDEDSEADRPKGLIGYVLDTDFVESLPVKVKYRVLALKKLQTRAANLESKFLREFHDIERKF
  AEMYQPLLEKRRQIINAIYEPTEEECEYKSDSEDCDDEEMCHEEMYGNEEGMVHEYVDEDDGYEDYYYDY
  AVEEEEEEEEEDDIEATGEENKEEEDPKGIPDFWLTVLKNVDTLTPLIKKYDEPILKLLTDIKVKLSDPG
  EPLSFTLEFHFKPNEYFKNELLTKTYVLKSKLAYYDPHPYRGTAIEYSTGCEIDWNEGKNVTLKTIKKKQ
  KHRIWGTIRTVTEDFPKDSFFNFFSPHGITSNGRDGNDDFLLGHNLRTYIIPRSVLFFSGDALESQQEGV
  VREVNDAIYDKIIYDNWMAAIEEVKACCKNLEALVEDIDR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_068798
• RefSeq Size: 2590
• RefSeq ORF: 1380
• Synonyms: BPX
• Locus ID: 4674
• UniProt ID: Q9ULW6
• Cytogenetics: Xq13.2
• Summary: The protein encoded by this intronless gene is a member of the nucleosome assembly protein (NAP) family. The encoded protein represents a class of tissue-specific factors that interact with chromatin to regulate neuronal cell proliferation. [provided by RefSeq, Jan 2011]