OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DNAJC5B (NM_033105) Human Mass Spec Standard

Be the first to review this product
SKU
PH305251
DNAJC5B MS Standard C13 and N15-labeled recombinant protein (NP_149096)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY409749 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 5 beta (DNAJC5B) (as WB positive control) 100 ug
$436.00

Other products for "DNAJC5B or NM_033105"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205251
Predicted MW 22.5 kDa
Protein Sequence
Protein Sequence
>RC205251 protein sequence
Red=Cloning site Green=Tags(s)

MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYRKLALKHHPDKNPDDPAATEKFKEINNAHAI
LTDISKRSIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKALFVIVGLLTGCYFCCCLCCCCNCCCGHC
RPESSVPEEDFYVSPEDLEEQIKSDMEKDVDFPVFLQPTNANEKTQLIKEGSRSYCTDS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_149096
RefSeq Size 1398
RefSeq ORF 597
Synonyms CSP-beta
Locus ID 85479
UniProt ID Q9UF47
Cytogenetics 8q13.1
Summary This gene encodes a member of the DNAJ heat shock protein 40 family of co-chaperone proteins that is characterized by an N-terminal DNAJ domain, a linker region, and a cysteine-rich C-terminal domain. The encoded protein, together with heat shock protein 70, is thought to regulate the proper folding of other proteins. The orthologous mouse protein is membrane-associated and is targeted to the trans-golgi network. provided by RefSeq, Mar 2017
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DNAJC5B" proteins (3)
SKU Description Size Price
LC409749 Lyophilized DNAJC5B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409749 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 5 beta (DNAJC5B) (as WB positive control) 100 ug
$436.00
TP305251 Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 5 beta (DNAJC5B), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products