OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ENOX1 (NM_017993) Human Mass Spec Standard

Be the first to review this product
SKU
PH305232
ENOX1 MS Standard C13 and N15-labeled recombinant protein (NP_060463)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA343865 Rabbit Polyclonal Anti-ENOX1 Antibody
100 ul
$585.00
LY402636 Transient overexpression lysate of ecto-NOX disulfide-thiol exchanger 1 (ENOX1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "ENOX1 or NM_017993"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205232
Predicted MW 73.3 kDa
Protein Sequence
Protein Sequence
>RC205232 protein sequence
Red=Cloning site Green=Tags(s)

MVDAGGVENITQLPQELPQMMAAAADGLGSIAIDTTQLNMSVTDPTAWATAMNNLGMVPVGLPGQQLVSD
SICVPGFDPSLNMMTGITPINPMIPGLGLVPPPPPTEVAVVKEIIHCKSCTLFPQNPNLPPPSTRERPPG
CKTVFVGGLPENATEEIIQEVFEQCGDITAIRKSKKNFCHIRFAEEFMVDKAIYLSGYRMRLGSSTDKKD
SGRLHVDFAQARDDFYEWECKQRMRAREERHRRKLEEDRLRPPSPPAIMHYSEHEAALLAEKLKDDSKFS
EAITVLLSWIERGEVNRRSANQFYSMVQSANSHVRRLMNEKATHEQEMEEAKENFKNALTGILTQFEQIV
AVFNASTRQKAWDHFSKAQRKNIDIWRKHSEELRNAQSEQLMGIRREEEMEMSDDENCDSPTKKMRVDES
ALAAQAYALKEENDSLRWQLDAYRNEVELLKQEKEQLFRTEENLTKDQQLQFLQQTMQGMQQQLLTIQEE
LNNKKSELEQAKEEQSHTQALLKVLQEQLKGTKELVETNGHSHEDSNEINVLTVALVNQDRENNIEKRSQ
GLKSEKEALLIGIISTFLHVHPFGANIEYLWSYMQQLDSKISANEIEMLLMRLPRMFKQEFTGVGATLEK
RWKLCAFEGIKTT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060463
RefSeq Size 3047
RefSeq ORF 1929
Synonyms bA64J21.1; cCNOX; CNOX; PIG38
Locus ID 55068
UniProt ID Q8TC92
Cytogenetics 13q14.11
Summary The protein encoded by this gene is involved in plasma membrane electron transport pathways. The encoded protein has both a hydroquinone (NADH) oxidase activity and a protein disulfide-thiol interchange activity. The two activities cycle with a periodicity of 24 minutes, with one activity being at its peak when the other is at its lowest. provided by RefSeq, Dec 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ENOX1" proteins (7)
SKU Description Size Price
PH326055 ENOX1 MS Standard C13 and N15-labeled recombinant protein (NP_001121087) 10 ug
$3,360.00
LC402636 Lyophilized ENOX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426824 Lyophilized ENOX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402636 Transient overexpression lysate of ecto-NOX disulfide-thiol exchanger 1 (ENOX1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY426824 Transient overexpression lysate of ecto-NOX disulfide-thiol exchanger 1 (ENOX1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP305232 Recombinant protein of human ecto-NOX disulfide-thiol exchanger 1 (ENOX1), transcript variant 1, 20 µg 20 ug
$867.00
TP326055 Recombinant protein of human ecto-NOX disulfide-thiol exchanger 1 (ENOX1), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products