OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PCNP (NM_020357) Human Mass Spec Standard

Be the first to review this product
SKU
PH305183
PCNP MS Standard C13 and N15-labeled recombinant protein (NP_065090)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA308483 Rabbit polyclonal antibody to PCNP (PEST proteolytic signal containing nuclear protein)
100 ul
$665.00
LY412527 Transient overexpression lysate of PEST proteolytic signal containing nuclear protein (PCNP) (as WB positive control) 100 ug
$436.00

Other products for "PCNP or NM_020357"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205183
Predicted MW 19 kDa
Protein Sequence
Protein Sequence
>RC205183 protein sequence
Red=Cloning site Green=Tags(s)

MADGKAGDEKPEKSQRAGAAGGPEEEAEKPVKTKTVSSSNGGESSSRSAEKRSAEEEAADLPTKPTKISK
FGFAIGSQTTKKASAISIKLGSSKPKETVPTLAPKTLSVAAAFNEDEDSEPEEMPQEAKMRMKNIGRDTP
TSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQDN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065090
RefSeq Size 2250
RefSeq ORF 534
Locus ID 57092
UniProt ID Q8WW12
Cytogenetics 3q12.3
Summary May be involved in cell cycle regulation.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PCNP" proteins (3)
SKU Description Size Price
LC412527 Lyophilized PCNP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412527 Transient overexpression lysate of PEST proteolytic signal containing nuclear protein (PCNP) (as WB positive control) 100 ug
$436.00
TP305183 Recombinant protein of human PEST proteolytic signal containing nuclear protein (PCNP), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products