GPR85 (NM_018970) Human Mass Spec Standard
CAT#: PH305181
GPR85 MS Standard C13 and N15-labeled recombinant protein (NP_061843)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205181 |
Predicted MW | 42 kDa |
Protein Sequence |
>RC205181 protein sequence
Red=Cloning site Green=Tags(s) MANYSHAADNILQNLSPLTAFLKLTSLGFIIGVSVVGNLLISILLVKDKTLHRAPYYFLLDLCCSDILRS AICFPFVFNSVKNGSTWTYGTLTCKVIAFLGVLSCFHTAFMLFCISVTRYLAIAHHRFYTKRLTFWTCLA VICMVWTLSVAMAFPPVLDVGTYSFIREEDQCAFQHRSFRANDSLGFMLLLALILLATQLVYLKLIFFVH DRRKMKPVQFVAAVSQNWTFHGPGASGQAAANWLAGFGRGPTPPTLLGIRQNANTTGRRRLLVLDEFKME KRISRMFYIMTFLFLTLWGPYLVACYWRVFARGPVVPGGFLTAAVWMSFAQAGINPFVCIFSNRELRRCF STTLLYCRKSRLPREPYCVI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_061843 |
RefSeq Size | 4948 |
RefSeq ORF | 1110 |
Synonyms | SREB; SREB2 |
Locus ID | 54329 |
UniProt ID | P60893, A4D0T8, Q8NEN2 |
Cytogenetics | 7q31.1 |
Summary | Members of the G protein-coupled receptor (GPCR) family, such as GPR85, have a similar structure characterized by 7 transmembrane domains. Activation of GPCRs by extracellular stimuli, such as neurotransmitters, hormones, or light, induces an intracellular signaling cascade mediated by heterotrimeric GTP-binding proteins, or G proteins (Matsumoto et al., 2000 [PubMed 10833454]).[supplied by OMIM, Aug 2008] |
Protein Families | Druggable Genome, GPCR, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402723 | GPR85 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC431877 | GPR85 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC431878 | GPR85 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC431879 | GPR85 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402723 | Transient overexpression lysate of G protein-coupled receptor 85 (GPR85), transcript variant 2 |
USD 436.00 |
|
LY431877 | Transient overexpression lysate of G protein-coupled receptor 85 (GPR85), transcript variant 1 |
USD 436.00 |
|
LY431878 | Transient overexpression lysate of G protein-coupled receptor 85 (GPR85), transcript variant 3 |
USD 436.00 |
|
LY431879 | Transient overexpression lysate of G protein-coupled receptor 85 (GPR85), transcript variant 4 |
USD 436.00 |
|
TP305181 | Recombinant protein of human G protein-coupled receptor 85 (GPR85), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review