GPR85 (NM_018970) Human Mass Spec Standard

CAT#: PH305181

GPR85 MS Standard C13 and N15-labeled recombinant protein (NP_061843)

Product Images

Coomassie blue staining of purified GPR85 protein (Cat# TP305181). The protein was produced from HEK293T cells transfected with GPR85 cDNA clone (Cat# RC205181) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205181
• Predicted MW: 42 kDa
• Protein Sequence:
  Sequence Link

  >RC205181 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MANYSHAADNILQNLSPLTAFLKLTSLGFIIGVSVVGNLLISILLVKDKTLHRAPYYFLLDLCCSDILRS
  AICFPFVFNSVKNGSTWTYGTLTCKVIAFLGVLSCFHTAFMLFCISVTRYLAIAHHRFYTKRLTFWTCLA
  VICMVWTLSVAMAFPPVLDVGTYSFIREEDQCAFQHRSFRANDSLGFMLLLALILLATQLVYLKLIFFVH
  DRRKMKPVQFVAAVSQNWTFHGPGASGQAAANWLAGFGRGPTPPTLLGIRQNANTTGRRRLLVLDEFKME
  KRISRMFYIMTFLFLTLWGPYLVACYWRVFARGPVVPGGFLTAAVWMSFAQAGINPFVCIFSNRELRRCF
  STTLLYCRKSRLPREPYCVI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_061843
• RefSeq Size: 4948
• RefSeq ORF: 1110
• Synonyms: SREB; SREB2
• Locus ID: 54329
• UniProt ID: P60893, A4D0T8, Q8NEN2
• Cytogenetics: 7q31.1
• Summary: Members of the G protein-coupled receptor (GPCR) family, such as GPR85, have a similar structure characterized by 7 transmembrane domains. Activation of GPCRs by extracellular stimuli, such as neurotransmitters, hormones, or light, induces an intracellular signaling cascade mediated by heterotrimeric GTP-binding proteins, or G proteins (Matsumoto et al., 2000 [PubMed 10833454]).[supplied by OMIM, Aug 2008]
• Protein Families: Druggable Genome, GPCR, Transmembrane