SNRPG (NM_003096) Human Mass Spec Standard

CAT#: PH305113

SNRPG MS Standard C13 and N15-labeled recombinant protein (NP_003087)

Product Images

Coomassie blue staining of purified SNRPG protein (Cat# TP305113). The protein was produced from HEK293T cells transfected with SNRPG cDNA clone (Cat# RC205113) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205113
• Predicted MW: 8.5 kDa
• Protein Sequence:
  Sequence Link

  >RC205113 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIML
  EALERV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003087
• RefSeq Size: 606
• RefSeq ORF: 228
• Synonyms: Sm-G; SMG
• Locus ID: 6637
• UniProt ID: P62308
• Cytogenetics: 2p13.3
• Summary: The protein encoded by this gene is a component of the U1, U2, U4, and U5 small nuclear ribonucleoprotein complexes, precursors of the spliceosome. The encoded protein may also be a part of the U7 small nuclear ribonucleoprotein complex, which participates in the processing of the 3' end of histone transcripts. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]
• Protein Families: Druggable Genome
• Protein Pathways: Spliceosome