OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GLT8D2 (NM_031302) Human Mass Spec Standard

Be the first to review this product
SKU
PH305001
GLT8D2 MS Standard C13 and N15-labeled recombinant protein (NP_112592)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA339578 Rabbit Polyclonal Anti-GLT8D2 Antibody
100 ul
$585.00
LY410552 Transient overexpression lysate of glycosyltransferase 8 domain containing 2 (GLT8D2) (as WB positive control) 100 ug
$436.00

Other products for "GLT8D2 or NM_031302"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205001
Predicted MW 40 kDa
Protein Sequence
Protein Sequence
>RC205001 protein sequence
Red=Cloning site Green=Tags(s)

MALLRKINQVLLFLLIVTLCVILYKKVHKGTVPKNDADDESETPEELEEEIPVVICAAAGRMGATMAAIN
SIYSNTDANILFYVVGLRNTLTRIRKWIEHSKLREINFKIVEFNPMVLKGKIRPDSSRPELLQPLNFVRF
YLPLLIHQHEKVIYLDDDVIVQGDIQELYDTTLALGHAAAFSDDCDLPSAQDINRLVGLQNTYMGYLDYR
KKAIKDLGISPSTCSFNPGVIVANMTEWKHQRITKQLEKWMQKNVEENLYSSSLGGGVATSPMLIVFHGK
YSTINPLWHIRHLGWNPDARYSEHFLQEAKLLHWNGRHKPWDFPSVHNDLWESWFVPDPAGIFKLNHHS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_112592
RefSeq Size 1906
RefSeq ORF 1047
Locus ID 83468
UniProt ID Q9H1C3
Cytogenetics 12q23.3
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GLT8D2" proteins (3)
SKU Description Size Price
LC410552 Lyophilized GLT8D2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410552 Transient overexpression lysate of glycosyltransferase 8 domain containing 2 (GLT8D2) (as WB positive control) 100 ug
$436.00
TP305001 Recombinant protein of human glycosyltransferase 8 domain containing 2 (GLT8D2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products