GLT8D2 Rabbit Polyclonal Antibody

SKU TA339578

Rabbit Polyclonal Anti-GLT8D2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GLT8D2 antibody: synthetic peptide directed towards the C terminal of human GLT8D2. Synthetic peptide located within the following region: IRHLGWNPDARYSEHFLQEAKLLHWNGRHKPWDFPSVHNDLWESWFVPDP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 40 kDa
• Gene Name: glycosyltransferase 8 domain containing 2
• Database Link:
  NP_112592
  Q9H1C3
• Background: GLT8D2 belongs to the glycosyltransferase 8 family. The exact function of it remains unknown
• Synonyms: FLJ31494
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 77%

Reference Data

• Protein Families: Transmembrane