OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PC4 (SUB1) (NM_006713) Human Mass Spec Standard

Be the first to review this product
SKU
PH304999
SUB1 MS Standard C13 and N15-labeled recombinant protein (NP_006704)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA809399 SUB1 mouse monoclonal antibody,clone OTI4C10 100 ul
$447.00
LY402009 Transient overexpression lysate of SUB1 homolog (S. cerevisiae) (SUB1) (as WB positive control) 100 ug
$436.00

Other products for "PC4 or NM_006713"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204999
Predicted MW 14.4 kDa
Protein Sequence
Protein Sequence
>RC204999 protein sequence
Red=Cloning site Green=Tags(s)

MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMR
YVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006704
RefSeq Size 3522
RefSeq ORF 381
Synonyms p14; P15; PC4
Locus ID 10923
UniProt ID P53999
Cytogenetics 5p13.3
Summary General coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. May be involved in stabilizing the multiprotein transcription complex. Binds single-stranded DNA. Also binds, in vitro, non-specifically to double-stranded DNA (ds DNA).UniProtKB/Swiss-Prot Function
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PC4" proteins (3)
SKU Description Size Price
LC402009 Lyophilized SUB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402009 Transient overexpression lysate of SUB1 homolog (S. cerevisiae) (SUB1) (as WB positive control) 100 ug
$436.00
TP304999 Recombinant protein of human SUB1 homolog (S. cerevisiae) (SUB1), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products