OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DPY30 (NM_032574) Human Mass Spec Standard

Be the first to review this product
SKU
PH304981
DPY30 MS Standard C13 and N15-labeled recombinant protein (NP_115963)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY410030 Transient overexpression lysate of dpy-30 homolog (C. elegans) (DPY30) (as WB positive control) 100 ug
$436.00

Other products for "DPY30 or NM_032574"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204981
Predicted MW 11.2 kDa
Protein Sequence
Protein Sequence
>RC204981 protein sequence
Red=Cloning site Green=Tags(s)

MEPEQMLEGQTQVAENPHSEYGLTDNVERIVENEKINAEKSSKQKVDLQSLPTRAYLDQTVVPILLQGLA
VLAKERPPNPIEFLASYLLKNKAQFEDRN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115963
RefSeq Size 800
RefSeq ORF 297
Synonyms Cps25; HDPY-30; Saf19
Locus ID 84661
UniProt ID Q9C005
Cytogenetics 2p22.3
Summary This gene encodes an integral core subunit of the SET1/MLL family of H3K4 methyltransferases. The encoded protein directly controls cell cycle regulators and plays an important role in the proliferation and differentiation of human hematopoietic progenitor cells. provided by RefSeq, Mar 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DPY30" proteins (3)
SKU Description Size Price
LC410030 Lyophilized DPY30 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410030 Transient overexpression lysate of dpy-30 homolog (C. elegans) (DPY30) (as WB positive control) 100 ug
$436.00
TP304981 Recombinant protein of human dpy-30 homolog (C. elegans) (DPY30), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products