OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

UBL7 (NM_032907) Human Mass Spec Standard

Be the first to review this product
SKU
PH304907
UBL7 MS Standard C13 and N15-labeled recombinant protein (NP_116296)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY404592 Transient overexpression lysate of ubiquitin-like 7 (bone marrow stromal cell-derived) (UBL7), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "UBL7 or NM_032907"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204907
Predicted MW 40.3 kDa
Protein Sequence
Protein Sequence
>RC204907 representing NM_032907
Red=Cloning site Green=Tags(s)

MSLSDWHLAVKLADQPLTPKSILRLPETELGEYSLGGYSISFLKQLIAGKLQESVPDPELIDLIYCGRKL
KDDQTLDFYGIQPGSTVHVLRKSWPEPDQKPEPVDKVAAMREFRVLHTALHSSSSYREAVFKMLSNKESL
DQIIVATPGLSSDPIALGVLQDKDLFSVFADPNMLDTLVPAHPALVNAIVLVLHSVAGSAPMPGTDSSSR
SMPSSSYRDMPGGFLFEGLSDDEDDFHPNTRSTPSSSTPSSRPASLGYSGAAGPRPITQSELATALALAS
TPESSSHTPTPGTQGHSSGTSPMSSGVQSGTPITNDLFSQALQHALQASGQPSLQSQWQPQLQQLRDMGI
QDDELSLRALQATGGDIQAALELIFAGGAP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_116296
RefSeq Size 1461
RefSeq ORF 1140
Synonyms BMSC-UbP; TCBA1
Locus ID 84993
UniProt ID Q96S82
Cytogenetics 15q24.1
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "UBL7" proteins (7)
SKU Description Size Price
PH314894 UBL7 MS Standard C13 and N15-labeled recombinant protein (NP_957717) 10 ug
$3,360.00
LC404592 Lyophilized UBL7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409867 Lyophilized UBL7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404592 Transient overexpression lysate of ubiquitin-like 7 (bone marrow stromal cell-derived) (UBL7), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY409867 Transient overexpression lysate of ubiquitin-like 7 (bone marrow stromal cell-derived) (UBL7), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP304907 Recombinant protein of human ubiquitin-like 7 (bone marrow stromal cell-derived) (UBL7), transcript variant 1, 20 µg 20 ug
$737.00
TP314894 Recombinant protein of human ubiquitin-like 7 (bone marrow stromal cell-derived) (UBL7), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products