SERPINE2 (NM_006216) Human Mass Spec Standard

CAT#: PH304904

SERPINE2 MS Standard C13 and N15-labeled recombinant protein (NP_006207)

Product Images

Coomassie blue staining of purified SERPINE2 protein (Cat# TP304904). The protein was produced from HEK293T cells transfected with SERPINE2 cDNA clone (Cat# RC204904) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204904
• Predicted MW: 44 kDa
• Protein Sequence:
  Sequence Link

  >RC204904 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNWHLPLFLLASVTLPSICSHFNPLSLEELGSNTGIQVFNQIVKSRPHDNIVISPHGIASVLGMLQLGAD
  GRTKKQLAMVMRYGVNGVGKILKKINKAIVSKKNKDIVTVANAVFVKNASEIEVPFVTRNKDVFQCEVRN
  VNFEDPASACDSINAWVKNETRDMIDNLLSPDLIDGVLTRLVLVNAVYFKGLWKSRFQPENTKKRTFVAA
  DGKSYQVPMLAQLSVFRCGSTSAPNDLWYNFIELPYHGESISMLIALPTESSTPLSAIIPHISTKTIDSW
  MSIMVPKRVQVILPKFTAVAQTDLKEPLKVLGITDMFDSSKANFAKITTGSENLHVSHILQKAKIEVSED
  GTKASAATTAILIARSSPPWFIVDRPFLFFIRHNPTGAVLFMGQINKP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006207
• RefSeq Size: 2259
• RefSeq ORF: 1194
• Synonyms: GDN; GDNPF; PI-7; PI7; PN-1; PN1; PNI
• Locus ID: 5270
• UniProt ID: P07093, A0A024R451
• Cytogenetics: 2q36.1
• Summary: This gene encodes a member of the serpin family of proteins, a group of proteins that inhibit serine proteases. Thrombin, urokinase, plasmin and trypsin are among the proteases that this family member can inhibit. This gene is a susceptibility gene for chronic obstructive pulmonary disease and for emphysema. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]
• Protein Families: Druggable Genome, Secreted Protein