OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

COPZ2 (NM_016429) Human Mass Spec Standard

Be the first to review this product
SKU
PH304853
COPZ2 MS Standard C13 and N15-labeled recombinant protein (NP_057513)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY414016 Transient overexpression lysate of coatomer protein complex, subunit zeta 2 (COPZ2) (as WB positive control) 100 ug
$436.00

Other products for "COPZ2 or NM_016429"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204853
Predicted MW 23.5 kDa
Protein Sequence
Protein Sequence
>RC204853 protein sequence
Red=Cloning site Green=Tags(s)

MQRPEAWPRPHPGEGAAAAQAGGPAPPARAGEPSGLRLQEPSLYTIKAVFILDNDGRRLLAKYYDDTFPS
MKEQMVFEKNVFNKTSRTESEIAFFGGMTIVYKNSIDLFLYVVGSSYENELMLMSVLTCLFESLNHMLRK
NVEKRWLLENMDGAFLVLDEIVDGGVILESDPQQVIQKVNFRADDGGLTEQSVAQVLQSAKEQIKWSLLK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057513
RefSeq Size 939
RefSeq ORF 630
Synonyms zeta2-COP
Locus ID 51226
UniProt ID Q9P299
Cytogenetics 17q21.32
Summary This gene encodes a member of the adaptor complexes small subunit family. The encoded protein is a subunit of the coatomer protein complex, a seven-subunit complex that functions in the formation of COPI-type, non-clathrin-coated vesicles. COPI vesicles function in the retrograde Golgi-to-ER transport of dilysine-tagged proteins. provided by RefSeq, Feb 2014
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "COPZ2" proteins (3)
SKU Description Size Price
LC414016 Lyophilized COPZ2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414016 Transient overexpression lysate of coatomer protein complex, subunit zeta 2 (COPZ2) (as WB positive control) 100 ug
$436.00
TP304853 Recombinant protein of human coatomer protein complex, subunit zeta 2 (COPZ2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products