OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Granzyme A (GZMA) (NM_006144) Human Mass Spec Standard

Be the first to review this product
SKU
PH304852
GZMA MS Standard C13 and N15-labeled recombinant protein (NP_006135)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA376892 GZMA Rabbit polyclonal Antibody
100 ul
$410.00
LY416840 Transient overexpression lysate of granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) (GZMA) (as WB positive control) 100 ug
$436.00

Other products for "Granzyme A or NM_006144"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204852
Predicted MW 29 kDa
Protein Sequence
Protein Sequence
>RC204852 protein sequence
Red=Cloning site Green=Tags(s)

MRNSYRFLASSLSVVVSLLLIPEDVCEKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHC
NLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGD
DVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNG
DSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006135
RefSeq Size 913
RefSeq ORF 786
Synonyms CTLA3; HFSP
Locus ID 3001
UniProt ID P12544
Cytogenetics 5q11.2
Summary Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here is a T cell- and natural killer cell-specific serine protease that may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Protease, Secreted Protein
Protein Pathways Neuroactive ligand-receptor interaction
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Granzyme A" proteins (3)
SKU Description Size Price
LC416840 Lyophilized GZMA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416840 Transient overexpression lysate of granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) (GZMA) (as WB positive control) 100 ug
$436.00
TP304852 Recombinant protein of human granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) (GZMA), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products