Granzyme A (GZMA) (NM_006144) Human Tagged ORF Clone

SKU
RC204852
GZMA (Myc-DDK-tagged)-Human granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) (GZMA)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Granzyme A
Synonyms CTLA3; HFSP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204852 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGAACTCCTATAGATTTCTGGCATCCTCTCTCTCAGTTGTCGTTTCTCTCCTGCTAATTCCTGAAG
ATGTCTGTGAAAAAATTATTGGAGGAAATGAAGTAACTCCTCATTCAAGACCCTACATGGTCCTACTTAG
TCTTGACAGAAAAACCATCTGTGCTGGGGCTTTGATTGCAAAAGACTGGGTGTTGACTGCAGCTCACTGT
AACTTGAACAAAAGGTCCCAGGTCATTCTTGGGGCTCACTCAATAACCAGGGAAGAGCCAACAAAACAGA
TAATGCTTGTTAAGAAAGAGTTTCCCTATCCATGCTATGACCCAGCCACACGCGAAGGTGACCTTAAACT
TTTACAGCTGACGGAAAAAGCAAAAATTAACAAATATGTGACTATCCTTCATCTACCTAAAAAGGGGGAT
GATGTGAAACCAGGAACCATGTGCCAAGTTGCAGGGTGGGGCAGGACTCACAATAGTGCATCTTGGTCCG
ATACTCTGAGAGAAGTCAATATCACCATCATAGACAGAAAAGTCTGCAATGATCGAAATCACTATAATTT
TAACCCTGTGATTGGAATGAATATGGTTTGTGCTGGAAGCCTCCGAGGTGGAAGAGACTCGTGCAATGGA
GATTCTGGAAGCCCTTTGTTGTGCGAGGGTGTTTTCCGAGGGGTCACTTCCTTTGGCCTTGAAAATAAAT
GCGGAGACCCTCGTGGGCCTGGTGTCTATATTCTTCTCTCAAAGAAACACCTCAACTGGATAATTATGAC
TATCAAGGGAGCAGTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204852 protein sequence
Red=Cloning site Green=Tags(s)

MRNSYRFLASSLSVVVSLLLIPEDVCEKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHC
NLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGD
DVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNG
DSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006144
ORF Size 786 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006144.3
RefSeq Size 913 bp
RefSeq ORF 789 bp
Locus ID 3001
UniProt ID P12544
Cytogenetics 5q11.2
Domains Tryp_SPc
Protein Families Druggable Genome, Protease, Secreted Protein
Protein Pathways Neuroactive ligand-receptor interaction
MW 29 kDa
Summary Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here is a T cell- and natural killer cell-specific serine protease that may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Granzyme A (GZMA) (NM_006144) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204852L1 Lenti ORF clone of Human granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) (GZMA), Myc-DDK-tagged 10 ug
$600.00
RC204852L2 Lenti ORF clone of Human granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) (GZMA), mGFP tagged 10 ug
$600.00
RC204852L3 Lenti ORF clone of Human granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) (GZMA), Myc-DDK-tagged 10 ug
$600.00
RC204852L4 Lenti ORF clone of Human granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) (GZMA), mGFP tagged 10 ug
$600.00
RG204852 GZMA (tGFP-tagged) - Human granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) (GZMA) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC116272 GZMA (untagged)-Human granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) (GZMA) 10 ug
$300.00
SC320921 GZMA (untagged)-Human granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) (GZMA) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.