OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RNF25 (NM_022453) Human Mass Spec Standard

Be the first to review this product
SKU
PH304829
RNF25 MS Standard C13 and N15-labeled recombinant protein (NP_071898)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA319495 Anti-RNF25 (RABBIT) Antibody, 100 ug
100 ug
$870.00
LY411668 Transient overexpression lysate of ring finger protein 25 (RNF25) (as WB positive control) 100 ug
$436.00

Other products for "RNF25 or NM_022453"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204829
Predicted MW 51.2 kDa
Protein Sequence
Protein Sequence
>RC204829 protein sequence
Red=Cloning site Green=Tags(s)

MAASASAAAGEEDWVLPSEVEVLESIYLDELQVIKGNGRTSPWEIYITLHPATAEDQDSQYVCFTLVLQV
PAEYPHEVPQISIRNPRGLSDEQIHTILQVLGHVAKAGLGTAMLYELIEKGKEILTDNNIPHGQCVICLY
GFQEKEAFTKTPCYHYFHCHCLARYIQHMEQELKAQGQEQEQERQHATTKQKAVGVQCPVCREPLVYDLA
SLKAAPEPQQPMELYQPSAESLRQQEERKRLYQRQQERGGIIDLEAERNRYFISLQQPPAPAEPESAVDV
SKGSQPPSTLAAELSTSPAVQSTLPPPLPVATQHICEKIPGTRSNQQRLGETQKAMLDPPKPSRGPWRQP
ERRHPKGGECHAPKGTRDTQELPPPEGPLKEPMDLKPEPHSQGVEGPPQEKGPGSWQGPPPRRTRDCVRW
ERSKGRTPGSSYPRLPRGQGAYRPGTRRESLGLESKDGS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071898
RefSeq Size 1566
RefSeq ORF 1377
Synonyms AO7
Locus ID 64320
UniProt ID Q96BH1
Cytogenetics 2q35
Summary The protein encoded by this gene contains a RING finger motif. The mouse counterpart of this protein has been shown to interact with Rela, the p65 subunit of NF-kappaB (NFKB), and modulate NFKB-mediated transcription activity. The mouse protein also binds ubiquitin-conjugating enzymes (E2s) and is a substrate for E2-dependent ubiquitination. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RNF25" proteins (3)
SKU Description Size Price
LC411668 Lyophilized RNF25 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411668 Transient overexpression lysate of ring finger protein 25 (RNF25) (as WB positive control) 100 ug
$436.00
TP304829 Recombinant protein of human ring finger protein 25 (RNF25), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products