OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SERF2 (NM_001018108) Human Mass Spec Standard

Be the first to review this product
SKU
PH304784
SERF2 MS Standard C13 and N15-labeled recombinant protein (NP_001018118)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA309850 Rabbit Polyclonal SERF2 Antibody
100 ul
$610.00
LY422655 Transient overexpression lysate of small EDRK-rich factor 2 (SERF2) (as WB positive control) 100 ug
$436.00

Other products for "SERF2 or NM_001018108"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204784
Predicted MW 6.9 kDa
Protein Sequence
Protein Sequence
>RC204784 protein sequence
Red=Cloning site Green=Tags(s)

MTRGNQRELARQKNMKKQSDSVKGKRRDDGLSAAARKQRDSEIMQQKQKKANEKKEEPK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001018118
RefSeq Size 3048
RefSeq ORF 177
Synonyms 4F5REL; FAM2C; H4F5REL; HsT17089
Locus ID 10169
UniProt ID P84101
Cytogenetics 15q15.3
Summary Positive regulator of amyloid protein aggregation and proteotoxicity (PubMed:20723760). Induces conformational changes in amyloid proteins, such as HTT, driving them into compact formations preceding the formation of aggregates (PubMed:20723760).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SERF2" proteins (3)
SKU Description Size Price
LC422655 Lyophilized SERF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY422655 Transient overexpression lysate of small EDRK-rich factor 2 (SERF2) (as WB positive control) 100 ug
$436.00
TP304784 Recombinant protein of human small EDRK-rich factor 2 (SERF2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products