C3AR1 (NM_004054) Human Mass Spec Standard

CAT#: PH304730

C3AR1 MS Standard C13 and N15-labeled recombinant protein (NP_004045)

Product Images

Coomassie blue staining of purified C3AR1 protein (Cat# TP304730). The protein was produced from HEK293T cells transfected with C3AR1 cDNA clone (Cat# RC204730) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204730
• Predicted MW: 53.9 kDa
• Protein Sequence:
  Sequence Link

  >RC204730 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASFSAETNSTDLLSQPWNEPPVILSMVILSLTFLLGLPGNGLVLWVAGLKMQRTVNTIWFLHLTLADLL
  CCLSLPFSLAHLALQGQWPYGRFLCKLIPSIIVLNMFASVFLLTAISLDRCLVVFKPIWCQNHRNVGMAC
  SICGCIWVVAFVMCIPVFVYREIFTTDNHNRCGYKFGLSSSLDYPDFYGDPLENRSLENIVQPPGEMNDR
  LDPSSFQTNDHPWTVPTVFQPQTFQRPSADSLPRGSARLTSQNLYSNVFKPADVVSPKIPSGFPIEDHET
  SPLDNSDAFLSTHLKLFPSASSNSFYESELPQGFQDYYNLGQFTDDDQVPTPLVAITITRLVVGFLLPSV
  IMIACYSFIVFRMQRGRFAKSQSKTFRVAVVVVAVFLVCWTPYHIFGVLSLLTDPETPLGKTLMSWDHVC
  IALASANSCFNPFLYALLGKDFRKKARQSIQGILEAAFSEELTRSTHCPSNNVISERNSTTV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004045
• RefSeq Size: 1985
• RefSeq ORF: 1446
• Synonyms: AZ3B; C3AR; HNFAG09
• Locus ID: 719
• UniProt ID: Q16581, A8K2H7
• Cytogenetics: 12p13.31
• Summary: C3a is an anaphylatoxin released during activation of the complement system. The protein encoded by this gene is an orphan G protein-coupled receptor for C3a. Binding of C3a by the encoded receptor activates chemotaxis, granule enzyme release, superoxide anion production, and bacterial opsonization. [provided by RefSeq, May 2016]
• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Complement and coagulation cascades, Neuroactive ligand-receptor interaction