OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

VPREB3 (NM_013378) Human Mass Spec Standard

Be the first to review this product
SKU
PH304662
VPREB3 MS Standard C13 and N15-labeled recombinant protein (NP_037510)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA809818 VPREB3 mouse monoclonal antibody,clone OTI1A3 100 ul
$447.00
LY415623 Transient overexpression lysate of pre-B lymphocyte 3 (VPREB3) (as WB positive control) 100 ug
$436.00

Other products for "VPREB3 or NM_013378"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204662
Predicted MW 13.7 kDa
Protein Sequence
Protein Sequence
>RC204662 protein sequence
Red=Cloning site Green=Tags(s)

MACRCLSFLLMGTFLSVSQTVLAQLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLY
YRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_037510
RefSeq Size 602
RefSeq ORF 369
Synonyms 8HS20; N27C7-2
Locus ID 29802
UniProt ID Q9UKI3
Cytogenetics 22q11
Summary The protein encoded by this gene is the human ortholog of the mouse VpreB3 (8HS20) protein, is thought to be involved in B-cell maturation, and may play a role in assembly of the pre-B cell receptor (pre-BCR). While the role of this protein in B-cell development has not yet been elucidated, studies with the chicken ortholog of this protein have found that when overexpressed, this protein localizes to the endoplasmic reticulum. The mouse ortholog of this protein has been shown to associate with membrane mu heavy chains early in the course of pre-B cell receptor biosynthesis. Expression of this gene has been observed in some lymphomas. provided by RefSeq, Apr 2015
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "VPREB3" proteins (3)
SKU Description Size Price
LC415623 Lyophilized VPREB3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415623 Transient overexpression lysate of pre-B lymphocyte 3 (VPREB3) (as WB positive control) 100 ug
$436.00
TP304662 Recombinant protein of human pre-B lymphocyte 3 (VPREB3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products