OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ANKRD49 (NM_017704) Human Mass Spec Standard

Be the first to review this product
SKU
PH304657
ANKRD49 MS Standard C13 and N15-labeled recombinant protein (NP_060174)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA507228 ANKRD49 mouse monoclonal antibody, clone OTI3E4 (formerly 3E4) 100 ul
$447.00
LY413612 Transient overexpression lysate of ankyrin repeat domain 49 (ANKRD49) (as WB positive control) 100 ug
$436.00

Other products for "ANKRD49 or NM_017704"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204657
Predicted MW 27.3 kDa
Protein Sequence
Protein Sequence
>RC204657 protein sequence
Red=Cloning site Green=Tags(s)

MEKEKGNDDGIPDQENSLDFSEHFNQLELLETHGHLIPTGTQSLWVGNSDEDEEQDDKNEEWYRLQEKKM
EKDPSRLLLWAAEKNRLTTVRRLLSEKATHVNTRDEDEYTPLHRAAYSGHLDIVQELIAQGADVHAVTVD
GWTPLHSACKWNNTRVASFLLQHDADINAQTKGLLTPLHLAAGNRDSKDTLELLLMNRYVKPGLKNNLEE
TAFDIARRTSIYHYLFEIVEGCTNSSPQS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060174
RefSeq Size 1924
RefSeq ORF 717
Synonyms FGIF; GBIF
Locus ID 54851
UniProt ID Q8WVL7
Cytogenetics 11q21
Summary Induces HBG1 expression (PubMed:16131492, PubMed:11162141). May have a role in spermatogenesis where it promotes autophagy in response to serum starvation, via the NF-kappaB pathway (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ANKRD49" proteins (3)
SKU Description Size Price
LC413612 Lyophilized ANKRD49 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413612 Transient overexpression lysate of ankyrin repeat domain 49 (ANKRD49) (as WB positive control) 100 ug
$436.00
TP304657 Recombinant protein of human ankyrin repeat domain 49 (ANKRD49), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products