OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ARL8A (NM_138795) Human Mass Spec Standard

Be the first to review this product
SKU
PH304596
ARL8A MS Standard C13 and N15-labeled recombinant protein (NP_620150)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA364612 ARL8A rabbit polyclonal antibody
100 ul
$310.00
LY403368 Transient overexpression lysate of ADP-ribosylation factor-like 8A (ARL8A) (as WB positive control) 100 ug
$436.00

Other products for "ARL8A or NM_138795"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204596
Predicted MW 21.4 kDa
Protein Sequence
Protein Sequence
>RC204596 protein sequence
Red=Cloning site Green=Tags(s)

MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLW
DIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDE
KELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_620150
RefSeq Size 1815
RefSeq ORF 558
Synonyms ARL10B; GIE2
Locus ID 127829
UniProt ID Q96BM9
Cytogenetics 1q32.1
Summary Plays a role in lysosome motility (By similarity). In neurons, mediates the anterograde axonal long-range transport of presynaptic lysosome-related vesicles required for presynaptic biogenesis and synaptic function (By similarity). May play a role in chromosome segregation (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ARL8A" proteins (3)
SKU Description Size Price
LC403368 Lyophilized ARL8A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403368 Transient overexpression lysate of ADP-ribosylation factor-like 8A (ARL8A) (as WB positive control) 100 ug
$436.00
TP304596 Recombinant protein of human ADP-ribosylation factor-like 8A (ARL8A), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products