OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GTDC1 (NM_024659) Human Mass Spec Standard

Be the first to review this product
SKU
PH304594
GTDC1 MS Standard C13 and N15-labeled recombinant protein (NP_078935)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA346827 Rabbit Polyclonal Anti-GTDC1 Antibody
100 ul
$585.00
LY423533 Transient overexpression lysate of glycosyltransferase-like domain containing 1 (GTDC1), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "GTDC1 or NM_024659"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204594
Predicted MW 43 kDa
Protein Sequence
Protein Sequence
>RC204594 protein sequence
Red=Cloning site Green=Tags(s)

MSILIIEAFYGGSHKQLVDLLQEELGDCVVYTLPAKKWHWRARTSALYFSQTIPISEHYRTLFASSVLNL
TELAALRPDLGKLKKILYFHENQLIYPVKKCQERDFQYGYNQILSCLVADVVVFNSVFNMESFLTSMGKF
MKLIPDHRPKDLESIIRPKCQVIYFPIRFPDVSRFMPKHKTTHLKKMLGLKGNGGAVLSMALPFQPEQRD
SEDLLKNFNSECDTHCGLDTARQEYLGNSLRQESDLKKSTSSDNSSSHHGENKQNLTVDPCDILGGVDNQ
QRLLHIVWPHRWLEAVYCGCYPLCPKDLVYPEIFPAEYLYSTPEQLSKRLQNFCKRPDIIRKHLYKGEIA
PFSWAALHGKFRSLLTTEPREDL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_078935
RefSeq Size 2419
RefSeq ORF 1119
Synonyms Hmat-Xa; mat-Xa
Locus ID 79712
UniProt ID Q4AE62
Cytogenetics 2q22.3
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GTDC1" proteins (5)
SKU Description Size Price
LC411175 Lyophilized GTDC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423533 Lyophilized GTDC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411175 Transient overexpression lysate of glycosyltransferase-like domain containing 1 (GTDC1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY423533 Transient overexpression lysate of glycosyltransferase-like domain containing 1 (GTDC1), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP304594 Recombinant protein of human glycosyltransferase-like domain containing 1 (GTDC1), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products