RAB3IL1 (NM_013401) Human Mass Spec Standard

CAT#: PH304592

RAB3IL1 MS Standard C13 and N15-labeled recombinant protein (NP_037533)

Product Images

Coomassie blue staining of purified RAB3IL1 protein (Cat# TP304592). The protein was produced from HEK293T cells transfected with RAB3IL1 cDNA clone (Cat# RC204592) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204592
• Predicted MW: 42.6 kDa
• Protein Sequence:
  Sequence Link

  >RC204592 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MWSGPPQPDQGLPPPLAAVPVPWKSTDPCQGHRESPGALVETSAGEEAQGQEGPAAAQLDVLRLRSSSME
  IREKGSEFLKEELHRAQKELKLKDEECERLSKVREQLEQELEELTASLFEEAHKMVREANMKQAASEKQL
  KEARGKIDMLQAEVTALKTLVITSTPASPNRELHPQLLSPTKAGPRKGHSRHKSTSSTLCPAVCPAAGHT
  LTPDREGKEVDTILFAEFQAWRESPTLDKTCPFLERVYREDVGPCLDFTMQELSVLVRAAVEDNTLTIEP
  VASQTLPTVKVAEVDCSSTNTCALSGLTRTCRHRIRLGDSKSHYYISPSSRARITAVCNFFTYIRYIQQG
  LVRQDAEPMFWEIMRLRKEMSLAKLGFFPQEA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_037533
• RefSeq Size: 2392
• RefSeq ORF: 1146
• Synonyms: GRAB
• Locus ID: 5866
• UniProt ID: Q8TBN0
• Cytogenetics: 11q12.2-q12.3
• Summary: This gene encodes a guanine nucleotide exchange factor for the ras-related protein Rab3A. The encoded protein binds Rab3a and the inositol hexakisphosphate kinase InsP6K1. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 7. [provided by RefSeq, Nov 2012]