OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FLRT1 (NM_013280) Human Mass Spec Standard

Be the first to review this product
SKU
PH304557
FLRT1 MS Standard C13 and N15-labeled recombinant protein (NP_037412)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA309005 Rabbit Polyclonal antibody to FLRT1 (fibronectin leucine rich transmembrane protein 1)
100 ul
$665.00
LY415690 Transient overexpression lysate of fibronectin leucine rich transmembrane protein 1 (FLRT1) (as WB positive control) 100 ug
$436.00

Other products for "FLRT1 or NM_013280"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204557
Predicted MW 74.1 kDa
Protein Sequence
Protein Sequence
>RC204557 protein sequence
Red=Cloning site Green=Tags(s)

MVVAHPTATATTTPTATVTATVVMTTATMDLRDWLFLCYGLIAFLTEVIDSTTCPSVCRCDNGFIYCNDR
GLTSIPADIPDDATTLYLQNNQINNAGIPQDLKTKVNVQVIYLYENDLDEFPINLPRSLRELHLQDNNVR
TIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQLKLLFLSRNHLSSIPSGLPHTLEELRLDDNRI
STIPLHAFKGLNSLRRLVLDGNLLANQRIADDTFSRLQNLTELSLVRNSLAAPPLNLPSAHLQKLYLQDN
AISHIPYNTLAKMRELERLDLSNNNLTTLPRGLFDDLGNLAQLLLRNNPWFCGCNLMWLRDWVKARAAVV
NVRGLMCQGPEKVRGMAIKDITSEMDECFETGPQGGVANAAAKTTASNHASATTPQGSLFTLKAKRPGLR
LPDSNIDYPMATGDGAKTLAIHVKALTADSIRITWKATLPASSFRLSWLRLGHSPAVGSITETLVQGDKT
EYLLTALEPKSTYIICMVTMETSNAYVADETPVCAKAETADSYGPTTTLNQEQNAGPMASLPLAGIIGGA
VALVFLFLVLGAICWYVHQAGELLTRERAYNRGSRKKDDYMESGTKKDNSILEIRGPGLQMLPINPYRAK
EEYVVHTIFPSNGSSLCKATHTIGYGTTRGYRDGGIPDIDYSYT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_037412
RefSeq Size 3252
RefSeq ORF 2022
Synonyms SPG68
Locus ID 23769
UniProt ID Q9NZU1
Cytogenetics 11q13.1
Summary This gene encodes a member of the fibronectin leucine rich transmembrane protein (FLRT) family. The family members may function in cell adhesion and/or receptor signalling. Their protein structures resemble small leucine-rich proteoglycans found in the extracellular matrix. The encoded protein shares sequence similarity with two other family members, FLRT2 and FLRT3. This gene is expressed in kidney and brain. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FLRT1" proteins (4)
SKU Description Size Price
LC415690 Lyophilized FLRT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415690 Transient overexpression lysate of fibronectin leucine rich transmembrane protein 1 (FLRT1) (as WB positive control) 100 ug
$436.00
TP304557 Recombinant protein of human fibronectin leucine rich transmembrane protein 1 (FLRT1), 20 µg 20 ug
$867.00
TP720302 Recombinant protein of human fibronectin leucine rich transmembrane protein 1 (FLRT1) 10 ug
$235.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products