OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GFAP (NM_002055) Human Mass Spec Standard

Be the first to review this product
SKU
PH304548
GFAP MS Standard C13 and N15-labeled recombinant protein (NP_002046)
Size:
10 ug
  $3,360.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA500338 Anti-GFAP mouse monoclonal antibody, clone OTI4D11 (formerly 4D11) 100 ul
$447.00
LY419563 Transient overexpression lysate of glial fibrillary acidic protein (GFAP), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "GFAP or NM_002055"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204548
Predicted MW 49.9 kDa
Protein Sequence
Protein Sequence
>RC204548 protein sequence
Red=Cloning site Green=Tags(s)

MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNAGFKETRASER
AEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVE
RDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVRE
LQEQLARQQVHVELDVAKPDLTAALKEIRTQYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKH
EANDYRRQLQSLTCDLESLRGTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQ
DLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEV
IKESKQEHKDVM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002046
RefSeq Size 3097
RefSeq ORF 1296
Synonyms ALXDRD
Locus ID 2670
UniProt ID P14136
Cytogenetics 17q21.31
Summary This gene encodes one of the major intermediate filament proteins of mature astrocytes. It is used as a marker to distinguish astrocytes from other glial cells during development. Mutations in this gene cause Alexander disease, a rare disorder of astrocytes in the central nervous system. Alternative splicing results in multiple transcript variants encoding distinct isoforms. provided by RefSeq, Oct 2008
Protein Families ES Cell Differentiation/IPS
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GFAP" proteins (6)
SKU Description Size Price
LC419563 Lyophilized GFAP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427360 Lyophilized GFAP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419563 Transient overexpression lysate of glial fibrillary acidic protein (GFAP), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY427360 Transient overexpression lysate of glial fibrillary acidic protein (GFAP), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP304548 Recombinant protein of human glial fibrillary acidic protein (GFAP), transcript variant 1, 20 µg 20 ug
$867.00
TP762317 Purified recombinant protein of Human glial fibrillary acidic protein (GFAP), transcript variant 1, Leu292-End, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$260.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products