OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD84 (NM_003874) Human Mass Spec Standard

Be the first to review this product
SKU
PH304477
CD84 MS Standard C13 and N15-labeled recombinant protein (NP_003865)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA374489 CD84 Rabbit polyclonal Antibody
100 ul
$410.00
LY401277 Transient overexpression lysate of CD84 molecule (CD84) (as WB positive control) 100 ug
$436.00

Other products for "CD84 or NM_003874"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204477
Predicted MW 36.9 kDa
Protein Sequence
Protein Sequence
>RC204477 protein sequence
Red=Cloning site Green=Tags(s)

MAQHHLWILLLCLQTWPEAAGKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSET
APVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQS
LMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQ
LCADIAMGFRTHHTGLLSVLAMFFLLVLILSSVFLFRLFKRRQDAASKKTIYTYIMASRNTQPAESRIYD
EILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTSSYEIVI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003865
RefSeq Size 8245
RefSeq ORF 984
Synonyms hCD84; LY9B; mCD84; SLAMF5
Locus ID 8832
UniProt ID Q9UIB8
Cytogenetics 1q23.3
Summary This gene encodes a membrane glycoprotein that is a member of the signaling lymphocyte activation molecule (SLAM) family. This family forms a subset of the larger CD2 cell-surface receptor Ig superfamily. The encoded protein is a homophilic adhesion molecule that is expressed in numerous immune cells types and is involved in regulating receptor-mediated signaling in those cells. Alternate splicing results in multiple transcript variants. provided by RefSeq, Oct 2011
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD84" proteins (9)
SKU Description Size Price
LC401277 Lyophilized CD84 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432804 Lyophilized CD84 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432917 Lyophilized CD84 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401277 Transient overexpression lysate of CD84 molecule (CD84) (as WB positive control) 100 ug
$436.00
LY432804 Transient overexpression lysate of CD84 molecule (CD84), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY432917 Transient overexpression lysate of CD84 molecule (CD84), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP304477 Recombinant protein of human CD84 molecule (CD84), 20 µg 20 ug
$737.00
TP329804 Purified recombinant protein of Homo sapiens CD84 molecule (CD84), transcript variant 3, 20 µg 20 ug
$737.00
TP723970 Recombinant human SLAMF5 protein with C-terminal mouse Fc and 6×His tag 100 ug
$695.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products