OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Cleavage stimulation factor 2 (CSTF2) (NM_001325) Human Mass Spec Standard

Be the first to review this product
SKU
PH304450
CSTF2 MS Standard C13 and N15-labeled recombinant protein (NP_001316)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA311679 Rabbit polyclonal anti-CSTF2 antibody
100 ul
$380.00
LY400533 Transient overexpression lysate of cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa (CSTF2) (as WB positive control) 100 ug
$436.00

Other products for "Cleavage stimulation factor 2 or NM_001325"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204450
Predicted MW 61 kDa
Protein Sequence
Protein Sequence
>RC204450 protein sequence
Red=Cloning site Green=Tags(s)

MAGLTVRDPAVDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETA
LSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGTGAPVIESPYGETISPEDAPESISKAVASLPPEQM
FELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHRQTNIPTLIAGNPQPVHG
AGPGSGSNVSMNQQNPQAPQAQSLGGMHVNGAPPLMQASMQGGVPAPGQMPAAVTGPGPGSLAPGGGMQA
QVGMPGSGPVSMERGQVPMQDPRAAMQRGSLPANVPTPRGLLGDAPNDPRGGTLLSVTGEVEPRGYLGPP
HQGPPMHHVPGHESRGPPPHELRGGPLPEPRPLMAEPRGPMLDQRGPPLDGRGGRDPRGIDARGMEARAM
EARGLDARGLEARAMEARAMEARAMEARAMEARAMEVRGMEARGMDTRGPVPGPRGPIPSGMQGPSPINM
GAVVPQGSRQVPVMQGTGMQGASIQGGSQPGGFSPGQNQVTPQDHEKAALIMQVLQLTADQIAMLPPEQR
QSILILKEQIQKSTGAP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001316
RefSeq Size 2027
RefSeq ORF 1731
Synonyms CstF-64
Locus ID 1478
UniProt ID P33240
Cytogenetics Xq22.1
Summary This gene encodes a nuclear protein with an RRM (RNA recognition motif) domain. The protein is a member of the cleavage stimulation factor (CSTF) complex that is involved in the 3' end cleavage and polyadenylation of pre-mRNAs. Specifically, this protein binds GU-rich elements within the 3'-untranslated region of mRNAs. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Cleavage stimulation factor 2" proteins (3)
SKU Description Size Price
LC400533 Lyophilized CSTF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400533 Transient overexpression lysate of cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa (CSTF2) (as WB positive control) 100 ug
$436.00
TP304450 Recombinant protein of human cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa (CSTF2), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products