CHIC2 (NM_012110) Human Mass Spec Standard

SKU
PH304420
CHIC2 MS Standard C13 and N15-labeled recombinant protein (NP_036242)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204420]
Predicted MW 19.3 kDa
Protein Sequence
Protein Sequence
>RC204420 protein sequence
Red=Cloning site Green=Tags(s)

MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINR
VNSCLKKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSKRTRRSIEKLLEWENNRLYHKLCLHWRLSKRK
CETNNMMEYVILIEFLPKTPIFRPD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036242
RefSeq Size 1178
RefSeq ORF 495
Synonyms BTL
Locus ID 26511
UniProt ID Q9UKJ5
Cytogenetics 4q12
Summary This gene encodes a member of the CHIC family of proteins. The encoded protein contains a cysteine-rich hydrophobic (CHIC) motif, and is localized to vesicular structures and the plasma membrane. This gene is associated with some cases of acute myeloid leukemia. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:CHIC2 (NM_012110) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415979 CHIC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415979 Transient overexpression lysate of cysteine-rich hydrophobic domain 2 (CHIC2) 100 ug
$436.00
TP304420 Recombinant protein of human cysteine-rich hydrophobic domain 2 (CHIC2), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.