POP5 (NM_015918) Human Mass Spec Standard

CAT#: PH304400

POP5 MS Standard C13 and N15-labeled recombinant protein (NP_057002)

Product Images

Coomassie blue staining of purified POP5 protein (Cat# TP304400). The protein was produced from HEK293T cells transfected with POP5 cDNA clone (Cat# RC204400) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204400
• Predicted MW: 18.8 kDa
• Protein Sequence:
  Sequence Link

  >RC204400 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVRFKHRYLLCELVSDDPRCRLSLDDRVLSSLVRDTIARVHGTFGAAACSIGFAVRYLNAYTGIVLLRCR
  KEFYQLVWSALPFITYLENKGHRYPCFFNTLHVGGTIRTCQKFLIQYNRRQLLILLQNCTDEGEREAIQK
  SVTRSCLLEEEEESGEEAAEAME
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057002
• RefSeq Size: 801
• RefSeq ORF: 489
• Synonyms: hPop5; HSPC004; RPP2; RPP20
• Locus ID: 51367
• UniProt ID: Q969H6
• Cytogenetics: 12q24.31
• Summary: Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends (PubMed:11413139, PubMed:30454648). Also a component of the MRP ribonuclease complex, which cleaves pre-rRNA sequences (PubMed:28115465).[UniProtKB/Swiss-Prot Function]
• Protein Families: Stem cell - Pluripotency