OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PITPNB (NM_012399) Human Mass Spec Standard

Be the first to review this product
SKU
PH304262
PITPNB MS Standard C13 and N15-labeled recombinant protein (NP_036531)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA809305 PITPNB mouse monoclonal antibody,clone OTI6H10 100 ul
$447.00
LY415778 Transient overexpression lysate of phosphatidylinositol transfer protein, beta (PITPNB) (as WB positive control) 100 ug
$436.00

Other products for "PITPNB or NM_012399"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204262
Predicted MW 31.5 kDa
Protein Sequence
Protein Sequence
>RC204262 protein sequence
Red=Cloning site Green=Tags(s)

MVLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPA
FVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVH
IDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAYKLVTIKFKWWGLQSKVE
NFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAADV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036531
RefSeq Size 2981
RefSeq ORF 813
Synonyms PI-TP-beta; PtdInsTP; VIB1B
Locus ID 23760
UniProt ID P48739
Cytogenetics 22q12.1
Summary This gene encodes a cytoplasmic protein that catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes. This transfer activity is required for COPI complex-mediated retrograde transport from the Golgi apparatus to the endoplasmic reticulum. Alternative splicing of this gene results in multiple transcript variants. provided by RefSeq, Sep 2013
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PITPNB" proteins (3)
SKU Description Size Price
LC415778 Lyophilized PITPNB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415778 Transient overexpression lysate of phosphatidylinositol transfer protein, beta (PITPNB) (as WB positive control) 100 ug
$436.00
TP304262 Recombinant protein of human phosphatidylinositol transfer protein, beta (PITPNB), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products