OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SEPTIN6 (NM_145802) Human Mass Spec Standard

Be the first to review this product
SKU
PH304244
SEPT6 MS Standard C13 and N15-labeled recombinant protein (NP_665801)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA312371 Rabbit polyclonal anti-SEPT6 antibody
100 ul
$380.00
LY402410 Transient overexpression lysate of septin 6 (SEPT6), transcript variant II (as WB positive control) 100 ug
$436.00

Other products for "SEPTIN6 or NM_145802"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204244
Predicted MW 49.2 kDa
Protein Sequence
Protein Sequence
>RC204244 protein sequence
Red=Cloning site Green=Tags(s)

MAATDIARQVGEGCRTVPLAGHVGFDSLPDQLVNKSVSQGFCFNILCVGETGLGKSTLMDTLFNTKFEGE
PATHTQPGVQLQSNTYDLQESNVRLKLTIVSTVGFGDQINKEDSYKPIVEFIDAQFEAYLQEELKIRRVL
HTYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADAISKSELTKFKIKITSELVSNGV
QIYQFPTDDESVAEINGTMNAHLPFAVIGSTEELKIGNKMMRARQYPWGTVQVENEAHCDFVKLREMLIR
VNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVQRV
KEKEAELKEAEKELHEKFDRLKKLHQDEKKKLEDKKKSLDDEVNAFKQRKTAAELLQSQGSQAGGSQTLK
RDKEKKNFF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_665801
RefSeq Size 2564
RefSeq ORF 1287
Synonyms SEP2; SEPT2; SEPT6
Locus ID 23157
UniProt ID Q14141
Cytogenetics Xq24
Summary This gene is a member of the septin family of GTPases. Members of this family are required for cytokinesis. One version of pediatric acute myeloid leukemia is the result of a reciprocal translocation between chromosomes 11 and X, with the breakpoint associated with the genes encoding the mixed-lineage leukemia and septin 2 proteins. This gene encodes four transcript variants encoding three distinct isoforms. An additional transcript variant has been identified, but its biological validity has not been determined. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SEPTIN6" proteins (15)
SKU Description Size Price
PH306957 SEPT6 MS Standard C13 and N15-labeled recombinant protein (NP_055944) 10 ug
$3,360.00
PH309634 SEPT6 MS Standard C13 and N15-labeled recombinant protein (NP_665798) 10 ug
$3,360.00
PH318686 SEPT6 MS Standard C13 and N15-labeled recombinant protein (NP_665799) 10 ug
$3,360.00
LC402410 Lyophilized 42253 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407883 Lyophilized 42253 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407884 Lyophilized 42253 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407885 Lyophilized 42253 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402410 Transient overexpression lysate of septin 6 (SEPT6), transcript variant II (as WB positive control) 100 ug
$436.00
LY407883 Transient overexpression lysate of septin 6 (SEPT6), transcript variant I (as WB positive control) 100 ug
$436.00
LY407884 Transient overexpression lysate of septin 6 (SEPT6), transcript variant III (as WB positive control) 100 ug
$436.00
LY407885 Transient overexpression lysate of septin 6 (SEPT6), transcript variant V (as WB positive control) 100 ug
$436.00
TP304244 Recombinant protein of human septin 6 (SEPT6), transcript variant V, 20 µg 20 ug
$867.00
TP306957 Recombinant protein of human septin 6 (SEPT6), transcript variant II, 20 µg 20 ug
$867.00
TP309634 Recombinant protein of human septin 6 (SEPT6), transcript variant I, 20 µg 20 ug
$867.00
TP318686 Recombinant protein of human septin 6 (SEPT6), transcript variant III, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products