SEPTIN6 (NM_145800) Human Mass Spec Standard

SKU
PH318686
SEPT6 MS Standard C13 and N15-labeled recombinant protein (NP_665799)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC218686]
Predicted MW 48.7 kDa
Protein Sequence
Protein Sequence
>RC218686 representing NM_145800
Red=Cloning site Green=Tags(s)

MAATDIARQVGEGCRTVPLAGHVGFDSLPDQLVNKSVSQGFCFNILCVGETGLGKSTLMDTLFNTKFEGE
PATHTQPGVQLQSNTYDLQESNVRLKLTIVSTVGFGDQINKEDSYKPIVEFIDAQFEAYLQEELKIRRVL
HTYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADAISKSELTKFKIKITSELVSNGV
QIYQFPTDDESVAEINGTMNAHLPFAVIGSTEELKIGNKMMRARQYPWGTVQVENEAHCDFVKLREMLIR
VNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVQRV
KEKEAELKEAEKELHEKFDRLKKLHQDEKKKLEDKKKSLDDEVNAFKQRKTAAELLQSQGSQAGGSQTLK
RDKEKKN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_665799
RefSeq Size 2620
RefSeq ORF 1281
Synonyms SEP2; SEPT2; SEPT6
Locus ID 23157
UniProt ID Q14141
Cytogenetics Xq24
Summary This gene is a member of the septin family of GTPases. Members of this family are required for cytokinesis. One version of pediatric acute myeloid leukemia is the result of a reciprocal translocation between chromosomes 11 and X, with the breakpoint associated with the genes encoding the mixed-lineage leukemia and septin 2 proteins. This gene encodes four transcript variants encoding three distinct isoforms. An additional transcript variant has been identified, but its biological validity has not been determined. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:SEPTIN6 (NM_145800) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH304244 SEPT6 MS Standard C13 and N15-labeled recombinant protein (NP_665801) 10 ug
$3,255.00
PH306957 SEPT6 MS Standard C13 and N15-labeled recombinant protein (NP_055944) 10 ug
$3,255.00
PH309634 SEPT6 MS Standard C13 and N15-labeled recombinant protein (NP_665798) 10 ug
$3,255.00
LC402410 42253 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC407883 42253 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC407884 42253 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC407885 42253 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402410 Transient overexpression lysate of septin 6 (SEPT6), transcript variant II 100 ug
$436.00
LY407883 Transient overexpression lysate of septin 6 (SEPT6), transcript variant I 100 ug
$436.00
LY407884 Transient overexpression lysate of septin 6 (SEPT6), transcript variant III 100 ug
$436.00
LY407885 Transient overexpression lysate of septin 6 (SEPT6), transcript variant V 100 ug
$436.00
TP304244 Recombinant protein of human septin 6 (SEPT6), transcript variant V, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP306957 Recombinant protein of human septin 6 (SEPT6), transcript variant II, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP309634 Recombinant protein of human septin 6 (SEPT6), transcript variant I, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP318686 Recombinant protein of human septin 6 (SEPT6), transcript variant III, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.