OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RANGAP1 (NM_002883) Human Mass Spec Standard

Be the first to review this product
SKU
PH304223
RANGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_002874)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501265 Anti-RANGAP1 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4) 100 ul
$447.00
LY401016 Transient overexpression lysate of Ran GTPase activating protein 1 (RANGAP1) (as WB positive control) 100 ug
$436.00

Other products for "RANGAP1 or NM_002883"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204223
Predicted MW 63.5 kDa
Protein Sequence
Protein Sequence
>RC204223 protein sequence
Red=Cloning site Green=Tags(s)

MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNTVGVEAARVIA
KALEKKSELKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVQGFEALLKSSA
CFTLQELKLNNCGMGIGGGKILAAALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFRVIGTL
EEVHMPQNGINHPGITALAQAFAVNPLLRVINLNDNTFTEKGAVAMAETLKTLRQVEVINFGDCLVRSKG
AVAIADAIRGGLPKLKELNLSFCEIKRDAALAVAEAMADKAELEKLDLNGNTLGEEGCEQLQEVLEGFNM
AKVLASLSDDEDEEEEEEGEEEEEEAEEEEEEDEEEEEEEEEEEEEEPQQRGQGEKSATPSRKILDPNTG
EPAPVLSSPPPADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAV
QDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLL
AFVTKPNSALESCSFARHSLLQTLYKV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002874
RefSeq Size 3907
RefSeq ORF 1761
Synonyms Fug1; RANGAP; SD
Locus ID 5905
UniProt ID P46060
Cytogenetics 22q13.2
Summary This gene encodes a protein that associates with the nuclear pore complex and participates in the regulation of nuclear transport. The encoded protein interacts with Ras-related nuclear protein 1 (RAN) and regulates guanosine triphosphate (GTP)-binding and exchange. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jul 2013
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RANGAP1" proteins (3)
SKU Description Size Price
LC401016 Lyophilized RANGAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401016 Transient overexpression lysate of Ran GTPase activating protein 1 (RANGAP1) (as WB positive control) 100 ug
$436.00
TP304223 Recombinant protein of human Ran GTPase activating protein 1 (RANGAP1), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products