OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DAZAP1 (NM_018959) Human Mass Spec Standard

Be the first to review this product
SKU
PH304091
DAZAP1 MS Standard C13 and N15-labeled recombinant protein (NP_061832)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA343885 Rabbit Polyclonal Anti-DAZAP1 Antibody
100 ul
$525.00
LY406890 Transient overexpression lysate of DAZ associated protein 1 (DAZAP1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "DAZAP1 or NM_018959"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204091
Predicted MW 43.4 kDa
Protein Sequence
Protein Sequence
>RC204091 protein sequence
Red=Cloning site Green=Tags(s)

MNNSGADEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLAS
RPHTLDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVT
EVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPRDSKSQAPGQPGASQWGSRV
VPNAANGWAGQPPPTWQQGYGPQGMWVPAGQAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGF
PQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPPPATPGAAPLAFPPPPSQAAPDMSKPPTAQPDFPYGQYA
GYGQDLSGFGQGFSDPSQQPPSYGGPSVPGSGGPPAGGSGFGRGQNHNVQGFHPYRR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061832
RefSeq Size 2215
RefSeq ORF 1221
Locus ID 26528
UniProt ID Q96EP5
Cytogenetics 19p13.3
Summary In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis. This gene encodes a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL. Two isoforms are encoded by transcript variants of this gene. provided by RefSeq, Jul 2008
Protein Families Stem cell - Pluripotency
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DAZAP1" proteins (5)
SKU Description Size Price
LC406890 Lyophilized DAZAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC412847 Lyophilized DAZAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406890 Transient overexpression lysate of DAZ associated protein 1 (DAZAP1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY412847 Transient overexpression lysate of DAZ associated protein 1 (DAZAP1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP304091 Recombinant protein of human DAZ associated protein 1 (DAZAP1), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products