SMOC1 (NM_001034852) Human Mass Spec Standard

CAT#: PH304083

SMOC1 MS Standard C13 and N15-labeled recombinant protein (NP_001030024)

Product Images

Coomassie blue staining of purified SMOC1 protein (Cat# TP304083). The protein was produced from HEK293T cells transfected with SMOC1 cDNA clone (Cat# RC204083) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204083
• Predicted MW: 48.3 kDa
• Protein Sequence:
  Sequence Link

  >RC204083 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLPARCARLLTPHLLLVLVQLSPARGHRTTGPRFLISDRDPQCNLHCSRTQPKPICASDGRSYESMCEYQ
  RAKCRDPTLGVVHRGRCKDAGQSKCRLERAQALEQAKKPQEAVFVPECGEDGSFTQVQCHTYTGYCWCVT
  PDGKPISGSSVQNKTPVCSGSVTDKPLSQGNSGRKDDGSKPTPTMETQPVFDGDEITAPTLWIKHLVIKD
  SKLNNTNIRNSEKVYSCDQERQSALEEAQQNPREGIVIPECAPGGLYKPVQCHQSTGYCWCVLVDTGRPL
  PGTSTRYVMPSCESDARAKTTEADDPFKDRELPGCPEGKKMEFITSLLDALTTDMVQAINSAAPTGGGRF
  SEPDPSHTLEERVVHWYFSQLDSNSSNDINKREMKPFKRYVKKKAKPKKCARRFTDYCDLNKDKVISLPE
  LKGCLGVSKEVGRLV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001030024
• RefSeq Size: 3716
• RefSeq ORF: 1305
• Synonyms: OAS
• Locus ID: 64093
• UniProt ID: Q9H4F8
• Cytogenetics: 14q24.2
• Summary: This gene encodes a multi-domain secreted protein that may have a critical role in ocular and limb development. Mutations in this gene are associated with microphthalmia and limb anomalies. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2011]
• Protein Families: Secreted Protein