NRBF2 (NM_030759) Human Mass Spec Standard

CAT#: PH304061

NRBF2 MS Standard C13 and N15-labeled recombinant protein (NP_110386)

Product Images

Coomassie blue staining of purified NRBF2 protein (Cat# TP304061). The protein was produced from HEK293T cells transfected with NRBF2 cDNA clone (Cat# RC204061) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204061
• Predicted MW: 32.2 kDa
• Protein Sequence:
  Sequence Link

  >RC204061 representing NM_030759
  Red=Cloning site Green=Tags(s)
  
  MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLL
  IQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDT
  LLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGP
  IEKELDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDI
  LKGFMNN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_110386
• RefSeq Size: 1866
• RefSeq ORF: 861
• Synonyms: COPR; COPR1; COPR2; NRBF-2
• Locus ID: 29982
• UniProt ID: Q96F24
• Cytogenetics: 10q21.3
• Summary: May modulate transcriptional activation by target nuclear receptors. Can act as transcriptional activator (in vitro).[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome