OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PERP (NM_022121) Human Mass Spec Standard

Be the first to review this product
SKU
PH304012
PERP MS Standard C13 and N15-labeled recombinant protein (NP_071404)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA303106 Goat Polyclonal Antibody against PERP
100 ug
$565.00
LY411759 Transient overexpression lysate of PERP, TP53 apoptosis effector (PERP) (as WB positive control) 100 ug
$436.00

Other products for "PERP or NM_022121"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204012
Predicted MW 21.4 kDa
Protein Sequence
Protein Sequence
>RC204012 protein sequence
Red=Cloning site Green=Tags(s)

MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLME
YAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLH
ANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071404
RefSeq Size 4319
RefSeq ORF 579
Synonyms dJ496H19.1; KCP1; KRTCAP1; PIGPC1; THW
Locus ID 64065
UniProt ID Q96FX8
Cytogenetics 6q23.3
Summary Component of intercellular desmosome junctions. Plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. Plays a role as an effector in the TP53-dependent apoptotic pathway (By similarity).UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome, Transmembrane
Protein Pathways p53 signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PERP" proteins (3)
SKU Description Size Price
LC411759 Lyophilized PERP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411759 Transient overexpression lysate of PERP, TP53 apoptosis effector (PERP) (as WB positive control) 100 ug
$436.00
TP304012 Recombinant protein of human PERP, TP53 apoptosis effector (PERP), 20 µg 20 ug
$737.00

file-alt Citations

ALCAM is indirectly modulated by miR-125b in MCF7 cells
Akman, Selcuklu, Donoghue et al
Tumour Biol. (2014)
Cited by 5
Snippet: One-way ANOVA with Tukey's multiple comparison post test was performed using GraphPad Prism software. For patient samples, Origene Breast Cancer cDNA array IV (BCRT504) was used (three technical replicates) (for patient characteristics, please see Supp. ... Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products