OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MRPS6 (NM_032476) Human Mass Spec Standard

Be the first to review this product
SKU
PH304000
MRPS6 MS Standard C13 and N15-labeled recombinant protein (NP_115865)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA338949 Rabbit Polyclonal Anti-MRPS6 Antibody
100 ul
$585.00
LY410105 Transient overexpression lysate of mitochondrial ribosomal protein S6 (MRPS6), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00

Other products for "MRPS6 or NM_032476"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204000
Predicted MW 14.2 kDa
Protein Sequence
Protein Sequence
>RC204000 protein sequence
Red=Cloning site Green=Tags(s)

MPRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNRGGYFLVDFYA
PTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115865
RefSeq Size 1017
RefSeq ORF 375
Synonyms C21orf101; MRP-S6; RPMS6; S6mt
Locus ID 64968
UniProt ID P82932
Cytogenetics 21q22.11
Summary Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S6P family. Pseudogenes corresponding to this gene are found on chromosomes 1p and 12q. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MRPS6" proteins (3)
SKU Description Size Price
LC410105 Lyophilized MRPS6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410105 Transient overexpression lysate of mitochondrial ribosomal protein S6 (MRPS6), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00
TP304000 Recombinant protein of human mitochondrial ribosomal protein S6 (MRPS6), nuclear gene encoding mitochondrial protein, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products