STEAP1 (NM_012449) Human Mass Spec Standard

CAT#: PH303970

STEAP1 MS Standard C13 and N15-labeled recombinant protein (NP_036581)

Product Images

Coomassie blue staining of purified STEAP1 protein (Cat# TP303970). The protein was produced from HEK293T cells transfected with STEAP1 cDNA clone (Cat# RC203970) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203970
• Predicted MW: 39.9 kDa
• Protein Sequence:
  Sequence Link

  >RC203970 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQ
  WHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQ
  LHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIE
  HDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDI
  KQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036581
• RefSeq Size: 1330
• RefSeq ORF: 1017
• Synonyms: PRSS24; STEAP
• Locus ID: 26872
• UniProt ID: Q9UHE8
• Cytogenetics: 7q21.13
• Summary: This gene is predominantly expressed in prostate tissue, and is found to be upregulated in multiple cancer cell lines. The gene product is predicted to be a six-transmembrane protein, and was shown to be a cell surface antigen significantly expressed at cell-cell junctions. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane