OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

STEAP1 (NM_012449) Human Mass Spec Standard

Be the first to review this product
SKU
PH303970
STEAP1 MS Standard C13 and N15-labeled recombinant protein (NP_036581)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA306463 Rabbit Polyclonal STEAP1 Antibody
100 ug
$640.00
LY402215 Transient overexpression lysate of six transmembrane epithelial antigen of the prostate 1 (STEAP1) (as WB positive control) 100 ug
$436.00

Other products for "STEAP1 or NM_012449"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203970
Predicted MW 39.9 kDa
Protein Sequence
Protein Sequence
>RC203970 protein sequence
Red=Cloning site Green=Tags(s)

MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQ
WHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQ
LHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIE
HDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDI
KQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036581
RefSeq Size 1330
RefSeq ORF 1017
Synonyms PRSS24; STEAP
Locus ID 26872
UniProt ID Q9UHE8
Cytogenetics 7q21.13
Summary This gene is predominantly expressed in prostate tissue, and is found to be upregulated in multiple cancer cell lines. The gene product is predicted to be a six-transmembrane protein, and was shown to be a cell surface antigen significantly expressed at cell-cell junctions. provided by RefSeq, Jul 2008
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "STEAP1" proteins (3)
SKU Description Size Price
LC402215 Lyophilized STEAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402215 Transient overexpression lysate of six transmembrane epithelial antigen of the prostate 1 (STEAP1) (as WB positive control) 100 ug
$436.00
TP303970 Recombinant protein of human six transmembrane epithelial antigen of the prostate 1 (STEAP1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products