OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ARMC7 (NM_024585) Human Mass Spec Standard

Be the first to review this product
SKU
PH303960
ARMC7 MS Standard C13 and N15-labeled recombinant protein (NP_078861)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA330740 Rabbit Polyclonal Anti-ARMC7 Antibody
100 ul
$585.00
LY411220 Transient overexpression lysate of armadillo repeat containing 7 (ARMC7) (as WB positive control) 100 ug
$436.00

Other products for "ARMC7 or NM_024585"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203960
Predicted MW 21.9 kDa
Protein Sequence
Protein Sequence
>RC203960 protein sequence
Red=Cloning site Green=Tags(s)

MAQKPKVDPHVGRLGYLQALVTEFQETQSQDAKEQVLANLANFAYDPSNYEYLRQLQVLDLFLDSLSEEN
ETLVEFAIGGLCNLCPDRANKEHILHAGGVPLIINCLSSPNEETVLSAITTLMHLSPPGRSFLPELTATP
VVQCMLRFSLSASARLRNLAQIFLEDFCSPRQVAEARSRQAHSALGIPLPRSVAPRQR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_078861
RefSeq Size 2146
RefSeq ORF 594
Locus ID 79637
UniProt ID Q9H6L4
Cytogenetics 17q25.1
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ARMC7" proteins (3)
SKU Description Size Price
LC411220 Lyophilized ARMC7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411220 Transient overexpression lysate of armadillo repeat containing 7 (ARMC7) (as WB positive control) 100 ug
$436.00
TP303960 Recombinant protein of human armadillo repeat containing 7 (ARMC7), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products