OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GTF3C5 (NM_012087) Human Mass Spec Standard

Be the first to review this product
SKU
PH303953
GTF3C5 MS Standard C13 and N15-labeled recombinant protein (NP_036219)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA339450 Rabbit Polyclonal Anti-GTF3C5 Antibody
100 ul
$585.00
LY426565 Transient overexpression lysate of general transcription factor IIIC, polypeptide 5, 63kDa (GTF3C5), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "GTF3C5 or NM_012087"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203953
Predicted MW 59.6 kDa
Protein Sequence
Protein Sequence
>RC203953 protein sequence
Red=Cloning site Green=Tags(s)

MAAEAADLGLGAAVPVELRRERRMVCVEYPGVVRDVAKMLPTLGGEEGVSRIYADPTKRLELYFRPKDPY
CHPVCANRFSTSSLLLRIRKRTRRQKGVLGTEAHSEVTFDMEILGIISTIYKFQGMSDFQYLAVHTEAGG
KHTSMYDKVLMLRPEKEAFFHQELPLYIPPPIFSRLDAPVDYFYRPETQHREGYNNPPISGENLIGLSRA
RRPHNAIFVNFEDEEVPKQPLEAAAQTWRRVCTNPVDRKVEEELRKLFDIRPIWSRNAVKANISVHPDKL
KVLLPFIAYYMITGPWRSLWIRFGYDPRKNPDAKIYQVLDFRIRCGMKHGYAPSDLPVKAKRSTYNYSLP
ITVKKTSSQLVTMHDLKQGLGPSGTSGARKPASSKYKLKDSVYIFREGALPPYRQMFYQLCDLNVEELQK
IIHRNDGAENSCTERDGWCLPKTSDELRDTMSLMIRQTIRSKRPALFSSSAKADGGKEQLTYESGEDEED
EEEEEEEEEDFKPSDGSENEMETEILDYV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036219
RefSeq Size 2436
RefSeq ORF 1557
Synonyms TFiiiC2-63; TFIIIC63; TFIIICepsilon
Locus ID 9328
UniProt ID Q9Y5Q8
Cytogenetics 9q34.13
Summary Involved in RNA polymerase III-mediated transcription. Integral, tightly associated component of the DNA-binding TFIIIC2 subcomplex that directly binds tRNA and virus-associated RNA promoters.UniProtKB/Swiss-Prot Function
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GTF3C5" proteins (5)
SKU Description Size Price
LC415990 Lyophilized GTF3C5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426565 Lyophilized GTF3C5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415990 Transient overexpression lysate of general transcription factor IIIC, polypeptide 5, 63kDa (GTF3C5), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY426565 Transient overexpression lysate of general transcription factor IIIC, polypeptide 5, 63kDa (GTF3C5), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP303953 Recombinant protein of human general transcription factor IIIC, polypeptide 5, 63kDa (GTF3C5), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products