OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

AFAP1L2 (NM_032550) Human Mass Spec Standard

Be the first to review this product
SKU
PH303918
AFAP1L2 MS Standard C13 and N15-labeled recombinant protein (NP_115939)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA306798 Rabbit Polyclonal AFAP1L2 Antibody
100 ug
$640.00
LY424282 Transient overexpression lysate of actin filament associated protein 1-like 2 (AFAP1L2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "AFAP1L2 or NM_032550"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203918
Predicted MW 90.9 kDa
Protein Sequence
Protein Sequence
>RC203918 protein sequence
Red=Cloning site Green=Tags(s)

MERYKALEQLLTELDDFLKILDQENLSSTALVKKSCLAELLRLYTKSSSSDEEYIYMNKVTINKQQNAES
QGKAPEEQGLLPNGEPSQHSSAPQKSLPDLPPPKMIPERKQLAIPKTESPEGYYEEAEPYDTSLNEDGEA
VSSSYESYDEEDGSKGKSAPYQWPSPEAGIELMRDARICAFLWRKKWLGQWAKQLCVIKDNRLLCYKSSK
DHSPQLDVNLLGSSVIHKEKQVRKKEHKLKITPMNADVIVLGLQSKDQAEQWLRVIQEVSGLPSEGASEG
NQYTPDAQRFNCQKPDIAEKYLSASEYGSSVDGHPEVPETKDVKKKCSAGLKLSNLMNLGRKKSTSLEPV
ERSLETSSYLNVLVNSQWKSRWCSVRDNHLHFYQDRNRSKVAQQPLSLVGCEVVPDPSPDHLYSFRILHK
GEELAKLEAKSSEEMGHWLGLLLSESGSKTDPEEFTYDYVDADRVSCIVSAAKNSLLLMQRKFSEPNTYI
DGLPSQDRQEELYDDVDLSELTAAVEPTEEATPVADDPNERESDRVYLDLTPVKSFLHGPSSAQAQASSP
TLSCLDNATEALPADSGPGPTPDEPCIKCPENLGEQQLESLEPEDPSLRITTVKIQTEQQRISFPPSCPD
AVVATPPGASPPVKDRLRVTSAEIKLGKNRTEAEVKRYTEEKERLEKKKEEIRGHLAQLRKEKRELKETL
LKCTDKEVLASLEQKLKEIDEECRGEESRRVDLELSIMEVKDNLKKAEAGPVTLGTTVDTTHLENPKAVT
PASAPDCTPVNSATTLKNRPLSVVVTGKGTVLQKAKEWEKKGAS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115939
RefSeq Size 4007
RefSeq ORF 2442
Synonyms CTB-1144G6.4; KIAA1914; XB130
Locus ID 84632
UniProt ID Q8N4X5
Cytogenetics 10q25.3
Summary May play a role in a signaling cascade by enhancing the kinase activity of SRC. Contributes to SRC-regulated transcription activation.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "AFAP1L2" proteins (7)
SKU Description Size Price
PH307705 AFAP1L2 MS Standard C13 and N15-labeled recombinant protein (NP_001001936) 10 ug
$3,360.00
LC410039 Lyophilized AFAP1L2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424282 Lyophilized AFAP1L2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410039 Transient overexpression lysate of actin filament associated protein 1-like 2 (AFAP1L2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY424282 Transient overexpression lysate of actin filament associated protein 1-like 2 (AFAP1L2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP303918 Recombinant protein of human actin filament associated protein 1-like 2 (AFAP1L2), transcript variant 2, 20 µg 20 ug
$867.00
TP307705 Recombinant protein of human actin filament associated protein 1-like 2 (AFAP1L2), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products