AFAP1L2 (NM_001001936) Human Recombinant Protein

SKU
TP307705
Recombinant protein of human actin filament associated protein 1-like 2 (AFAP1L2), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC207705 protein sequence
Red=Cloning site Green=Tags(s)

MERYKALEQLLTELDDFLKILDQENLSSTALVKKSCLAELLRLYTKSSSSDEEYIYMNKVTINKQQNAES
QGKAPEEQGLLPNGEPSQHSSAPQKSLPDLPPPKMIPERKQLAIPKTESPEGYYEEAEPYDTSLNEDGEA
VSSSYESYDEEDGSKGKSAPYQWPSPEAGIELMRDARICAFLWRKKWLGQWAKQLCVIKDNRLLCYKSSK
DHSPQLDVNLLGSSVIHKEKQVRKKEHKLKITPMNADVIVLGLQSKDQAEQWLRVIQEVSGLPSEGASEG
NQYTPDAQRFNCQKPDIAEKYLSASEYGSSVDGHPEVPETKDVKKKCSAGLKLSNLMNLGRKKSTSLEPV
ERSLETSSYLNVLVNSQWKSRWCSVRDNHLHFYQDRNRSKVAQQPLSLVGCEVVPDPSPDHLYSFRILHK
GEELAKLEAKSSEEMGHWLGLLLSESGSKTDPEEFTYDYVDADRVSCIVSAAKNSLLLMQRKFSEPNTYI
DGLPSQDRQEELYDDVDLSELTAAVEPTEEATPVADDPNERESDRVYLDLTPVKSFLHGPSSAQAQASSP
TLSCLDNATEALPADSGPGPTPDEPCIKCPENLGEQQLESLEPEDPSLRITTVKIQTEQQRISFPPSCPD
AVVATPPGASPPVKDRLRVTSAEIKLGKNRTEAEVKRYTEEKERLEKKKEEIRGHLAQLRKEKRELKETL
LKCTDKEVLASLEQKLKEIDEECRGEESRRVDLELSIMEVKDNLKKAEAGPVTLGTTVDTTHLENVSPRP
KAVTPASAPDCTPVNSATTLKNRPLSVVVTGKGTVLQKAKEWEKKGAS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 91.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001001936
Locus ID 84632
UniProt ID Q8N4X5
Cytogenetics 10q25.3
RefSeq Size 4019
RefSeq ORF 2454
Synonyms CTB-1144G6.4; KIAA1914; XB130
Summary May play a role in a signaling cascade by enhancing the kinase activity of SRC. Contributes to SRC-regulated transcription activation.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:AFAP1L2 (NM_001001936) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303918 AFAP1L2 MS Standard C13 and N15-labeled recombinant protein (NP_115939) 10 ug
$3,255.00
PH307705 AFAP1L2 MS Standard C13 and N15-labeled recombinant protein (NP_001001936) 10 ug
$3,255.00
LC410039 AFAP1L2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424282 AFAP1L2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410039 Transient overexpression lysate of actin filament associated protein 1-like 2 (AFAP1L2), transcript variant 2 100 ug
$436.00
LY424282 Transient overexpression lysate of actin filament associated protein 1-like 2 (AFAP1L2), transcript variant 1 100 ug
$436.00
TP303918 Recombinant protein of human actin filament associated protein 1-like 2 (AFAP1L2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.