OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

S100A16 (NM_080388) Human Mass Spec Standard

Be the first to review this product
SKU
PH303879
S100A16 MS Standard C13 and N15-labeled recombinant protein (NP_525127)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA365209 S100A16 rabbit polyclonal antibody
100 ul
$310.00
LY409181 Transient overexpression lysate of S100 calcium binding protein A16 (S100A16) (as WB positive control) 100 ug
$436.00

Other products for "S100A16 or NM_080388"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203879
Predicted MW 11.6 kDa
Protein Sequence
Protein Sequence
>RC203879 representing NM_080388
Red=Cloning site Green=Tags(s)

MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANH
DGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_525127
RefSeq Size 1085
RefSeq ORF 309
Synonyms AAG13; DT1P1A7; S100F
Locus ID 140576
UniProt ID Q96FQ6
Cytogenetics 1q21.3
Summary Calcium-binding protein. Binds one calcium ion per monomer (PubMed:17030513). Can promote differentiation of adipocytes (in vitro) (By similarity). Overexpression in preadipocytes increases their proliferation, enhances adipogenesis and reduces insulin-stimulated glucose uptake (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "S100A16" proteins (3)
SKU Description Size Price
LC409181 Lyophilized S100A16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409181 Transient overexpression lysate of S100 calcium binding protein A16 (S100A16) (as WB positive control) 100 ug
$436.00
TP303879 Purified recombinant protein of Homo sapiens S100 calcium binding protein A16 (S100A16), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products