TIM 4 (TIMD4) (NM_138379) Human Mass Spec Standard

CAT#: PH303848

TIMD4 MS Standard C13 and N15-labeled recombinant protein (NP_612388)

Product Images

Coomassie blue staining of purified TIMD4 protein (Cat# TP303848). The protein was produced from HEK293T cells transfected with TIMD4 cDNA clone (Cat# RC203848) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203848
• Predicted MW: 41.6 kDa
• Protein Sequence:
  Sequence Link

  >RC203848 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSKEPLILWLMIEFWWLYLTPVTSETVVTEVLGHRVTLPCLYSSWSHNSNSMCWGKDQCPYSGCKEALIR
  TDGMRVTSRKSAKYRLQGTIPRGDVSLTILNPSESDSGVYCCRIEVPGWFNDVKINVRLNLQRASTTTHR
  TATTTTRRTTTTSPTTTRQMTTTPAALPTTVVTTPDLTTGTPLQMTTIAVFTTANTCLSLTPSTLPEEAT
  GLLTPEPSKEGPILTAESETVLPSDSWSSAESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDSVSSPQP
  GASDTAVPEQNKTTKTGQMDGIPMSMKNEMPISQLLMIIAPSLGFVLFALFVAFLLRGKLMETYCSQKHT
  RLDYIGDSKNVLNDVQHGREDEDGLFTL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_612388
• RefSeq Size: 1374
• RefSeq ORF: 1134
• Synonyms: SMUCKLER; TIM4
• Locus ID: 91937
• UniProt ID: Q96H15
• Cytogenetics: 5q33.3
• Summary: Phosphatidylserine receptor that enhances the engulfment of apoptotic cells. Involved in regulating T-cell proliferation and lymphotoxin signaling. Ligand for HAVCR1/TIMD1 (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Transmembrane