TIM 4 (TIMD4) (NM_138379) Human Recombinant Protein

SKU
TP303848
Recombinant protein of human T-cell immunoglobulin and mucin domain containing 4 (TIMD4), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203848 protein sequence
Red=Cloning site Green=Tags(s)

MSKEPLILWLMIEFWWLYLTPVTSETVVTEVLGHRVTLPCLYSSWSHNSNSMCWGKDQCPYSGCKEALIR
TDGMRVTSRKSAKYRLQGTIPRGDVSLTILNPSESDSGVYCCRIEVPGWFNDVKINVRLNLQRASTTTHR
TATTTTRRTTTTSPTTTRQMTTTPAALPTTVVTTPDLTTGTPLQMTTIAVFTTANTCLSLTPSTLPEEAT
GLLTPEPSKEGPILTAESETVLPSDSWSSAESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDSVSSPQP
GASDTAVPEQNKTTKTGQMDGIPMSMKNEMPISQLLMIIAPSLGFVLFALFVAFLLRGKLMETYCSQKHT
RLDYIGDSKNVLNDVQHGREDEDGLFTL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 41.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_612388
Locus ID 91937
UniProt ID Q96H15
Cytogenetics 5q33.3
RefSeq Size 1374
RefSeq ORF 1134
Synonyms SMUCKLER; TIM4
Summary Phosphatidylserine receptor that enhances the engulfment of apoptotic cells. Involved in regulating T-cell proliferation and lymphotoxin signaling. Ligand for HAVCR1/TIMD1 (By similarity).[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:TIM 4 (TIMD4) (NM_138379) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303848 TIMD4 MS Standard C13 and N15-labeled recombinant protein (NP_612388) 10 ug
$3,255.00
LC408645 TIMD4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431308 TIMD4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408645 Transient overexpression lysate of T-cell immunoglobulin and mucin domain containing 4 (TIMD4), transcript variant 1 100 ug
$436.00
LY431308 Transient overexpression lysate of T-cell immunoglobulin and mucin domain containing 4 (TIMD4), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.