TIM 4 (TIMD4) (NM_138379) Human Mass Spec Standard

SKU
PH303848
TIMD4 MS Standard C13 and N15-labeled recombinant protein (NP_612388)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203848]
Predicted MW 41.6 kDa
Protein Sequence
Protein Sequence
>RC203848 protein sequence
Red=Cloning site Green=Tags(s)

MSKEPLILWLMIEFWWLYLTPVTSETVVTEVLGHRVTLPCLYSSWSHNSNSMCWGKDQCPYSGCKEALIR
TDGMRVTSRKSAKYRLQGTIPRGDVSLTILNPSESDSGVYCCRIEVPGWFNDVKINVRLNLQRASTTTHR
TATTTTRRTTTTSPTTTRQMTTTPAALPTTVVTTPDLTTGTPLQMTTIAVFTTANTCLSLTPSTLPEEAT
GLLTPEPSKEGPILTAESETVLPSDSWSSAESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDSVSSPQP
GASDTAVPEQNKTTKTGQMDGIPMSMKNEMPISQLLMIIAPSLGFVLFALFVAFLLRGKLMETYCSQKHT
RLDYIGDSKNVLNDVQHGREDEDGLFTL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_612388
RefSeq Size 1374
RefSeq ORF 1134
Synonyms SMUCKLER; TIM4
Locus ID 91937
UniProt ID Q96H15
Cytogenetics 5q33.3
Summary Phosphatidylserine receptor that enhances the engulfment of apoptotic cells. Involved in regulating T-cell proliferation and lymphotoxin signaling. Ligand for HAVCR1/TIMD1 (By similarity).[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:TIM 4 (TIMD4) (NM_138379) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC408645 TIMD4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431308 TIMD4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408645 Transient overexpression lysate of T-cell immunoglobulin and mucin domain containing 4 (TIMD4), transcript variant 1 100 ug
$436.00
LY431308 Transient overexpression lysate of T-cell immunoglobulin and mucin domain containing 4 (TIMD4), transcript variant 2 100 ug
$436.00
TP303848 Recombinant protein of human T-cell immunoglobulin and mucin domain containing 4 (TIMD4), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.